PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_03426.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 249aa    MW: 28627.8 Da    PI: 8.5948
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_03426.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1393e-4381352128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                               pGfrFhPt+eel++ yLk+ ++++kl+  ++i  ++iy ++Pw+Lp  ++ +e+ewyf ++ ++k+  + ++nr+t++g+Wkatg
  Sme2.5_03426.1_g00001.1   8 LPGFRFHPTEEELINLYLKRIINEDKLDY-NIIGLLNIYLYDPWKLPGLARIGEREWYFLVPINRKHGPKGKPNRTTRNGFWKATG 92 
                              59**************************9.89***************8778899******************************** PP

                      NAM  88 kdkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              +d+++ s+   ++++g+kktLvfy grapkg++tdWvm+eyrl
  Sme2.5_03426.1_g00001.1  93 SDRQIRSTlePKKVIGVKKTLVFYGGRAPKGTRTDWVMNEYRL 135
                              ******99888889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100550.8167152IPR003441NAC domain
SuperFamilySSF1019417.06E-528152IPR003441NAC domain
PfamPF023656.8E-249135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MSLVELQLPG FRFHPTEEEL INLYLKRIIN EDKLDYNIIG LLNIYLYDPW KLPGLARIGE  60
REWYFLVPIN RKHGPKGKPN RTTRNGFWKA TGSDRQIRST LEPKKVIGVK KTLVFYGGRA  120
PKGTRTDWVM NEYRLPHPHK DQDIVLCKVY RKAISFKVLE KRAMVEEDGA NTYLPSPDGQ  180
PIDMLASLES SKKDMYFTTC EEENHDTTVK LPELSGSDAS MEPSKFSIDT LSSPLWSTGQ  240
DLWSLFSLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B6e-42315512168NAC domain-containing protein 19
4dul_A6e-42315512168NAC domain-containing protein 19
1ut7_B6e-42315512168NO APICAL MERISTEM PROTEIN
1ut7_A6e-42315512168NO APICAL MERISTEM PROTEIN
1ut4_B6e-42315512168NO APICAL MERISTEM PROTEIN
1ut4_A6e-42315512168NO APICAL MERISTEM PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754411e-84HG975441.1 Solanum pennellii chromosome ch02, complete genome.
GenBankHG9755141e-84HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006367161.11e-145PREDICTED: NAC transcription factor 25-like isoform X2
SwissprotQ9FIW51e-48NAC94_ARATH; Putative NAC domain-containing protein 94
TrEMBLM1AGL41e-145M1AGL4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000223651e-145(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35312248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.14e-76NAC domain containing protein 36